PTM Viewer PTM Viewer

AT4G30590.1

Arabidopsis thaliana [ath]

early nodulin-like protein 12

No PTMs currently found

PLAZA: AT4G30590
Gene Family: HOM05D000332
Other Names: AtENODL12; ENODL12

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 190

MGIIVPVLTLVFLLFAKVSHGASNPRVILVGGSVGSWKVPDSPNNTLNHWAENNRFKVGDFIVWKYDMKVDSVLQVTKEDYESCNTANPLKQYNDGNTKVALDKSGPYFFISGAPGNCAKGEKITLVVLAERKSGGGSSSGDAPKVSPVSPTAQTPAPAPGPAAAHNAAVGLKVASGWFLTAVVVGLAMA

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR003245 26 130
Molecule Processing
Show Type From To
Propeptide 168 190
Signal Peptide 1 21

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here